PIM1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: PIM1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB583139
• Supplier Catalog Number: orb583139
• Alternative Catalog Number: BYT-ORB583139-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIM1
• Conjugation: Unconjugated
• Alternative Names: PIM

Product Description

Rabbit polyclonal antibody to PIM1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 36kDa
• NCBI: 002639
• UniProt: P11309
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
• Target: PIM1

Images

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Positive control (+): Mouse testis (M-TE), Negative control (-): Mouse brain (M-BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.