Human PPARA protein

Artikelnummer: BYT-ORB595008
Artikelname: Human PPARA protein
Artikelnummer: BYT-ORB595008
Hersteller Artikelnummer: orb595008
Alternativnummer: BYT-ORB595008-1,BYT-ORB595008-100,BYT-ORB595008-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Nuclear receptor subfamily 1 group C member 1 (NR1C1) (PPAR)
This Human PPARA protein spans the amino acid sequence from region 1-468aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 56.2 kDa
UniProt: Q07869
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) PPARA.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) PPARA.