Human PPARA protein

Catalog Number: BYT-ORB595008
Article Name: Human PPARA protein
Biozol Catalog Number: BYT-ORB595008
Supplier Catalog Number: orb595008
Alternative Catalog Number: BYT-ORB595008-1,BYT-ORB595008-100,BYT-ORB595008-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nuclear receptor subfamily 1 group C member 1 (NR1C1) (PPAR)
This Human PPARA protein spans the amino acid sequence from region 1-468aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 56.2 kDa
UniProt: Q07869
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) PPARA.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) PPARA.