Virus PS/HR protein

Produktübersicht

• Artikelname: Virus PS/HR protein
• Artikelnummer: BYT-ORB595055
• Hersteller Artikelnummer: orb595055
• Alternativnummer: BYT-ORB595055-1,BYT-ORB595055-100,BYT-ORB595055-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein B5

Produktbeschreibung

This Virus PS/HR protein spans the amino acid sequence from region 18-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 52.6 kDa
• UniProt: P24284
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Vaccinia virus (strain LC16m8) (VACV)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Vaccinia virus (strain LC16m8) (VACV). Application Notes: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR.