Virus PS/HR protein
Catalog Number:
BYT-ORB595055
- Images (3)
| Article Name: | Virus PS/HR protein |
| Biozol Catalog Number: | BYT-ORB595055 |
| Supplier Catalog Number: | orb595055 |
| Alternative Catalog Number: | BYT-ORB595055-1,BYT-ORB595055-100,BYT-ORB595055-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Protein B5 |
| This Virus PS/HR protein spans the amino acid sequence from region 18-92aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 52.6 kDa |
| UniProt: | P24284 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Vaccinia virus (strain LC16m8) (VACV) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK |
| Application Notes: | Biological Origin: Vaccinia virus (strain LC16m8) (VACV). Application Notes: Full Length of Mature Protein |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR. |
|
|
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain LC16m8) (VACV) PS/HR. |
Product Guarantee and Expert Support
