Virus Gorilla gorilla gorilla Fibroblast growth factor protein

Produktübersicht

• Artikelname: Virus Gorilla gorilla gorilla Fibroblast growth factor protein
• Artikelnummer: BYT-ORB595220
• Hersteller Artikelnummer: orb595220
• Alternativnummer: BYT-ORB595220-100,BYT-ORB595220-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: NCVP5 NS28

Produktbeschreibung

This Virus Gorilla gorilla gorilla Fibroblast growth factor protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 21.7 kDa
• UniProt: Q9PYC8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A). Application Notes: Cytoplasmic Domain

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rotavirus A (RV-A) glycoprotein 4.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rotavirus A (RV-A) glycoprotein 4.