Virus Gorilla gorilla gorilla Fibroblast growth factor protein
Catalog Number:
BYT-ORB595220
- Images (3)
| Article Name: | Virus Gorilla gorilla gorilla Fibroblast growth factor protein |
| Biozol Catalog Number: | BYT-ORB595220 |
| Supplier Catalog Number: | orb595220 |
| Alternative Catalog Number: | BYT-ORB595220-100,BYT-ORB595220-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | NCVP5 NS28 |
| This Virus Gorilla gorilla gorilla Fibroblast growth factor protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 21.7 kDa |
| UniProt: | Q9PYC8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM |
| Application Notes: | Biological Origin: Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A). Application Notes: Cytoplasmic Domain |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rotavirus A (RV-A) glycoprotein 4. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rotavirus A (RV-A) glycoprotein 4. |
Product Guarantee and Expert Support
