Drosophila RpS3 protein
Artikelnummer:
BYT-ORB604359
- Bilder (3)
| Artikelname: | Drosophila RpS3 protein |
| Artikelnummer: | BYT-ORB604359 |
| Hersteller Artikelnummer: | orb604359 |
| Alternativnummer: | BYT-ORB604359-1,BYT-ORB604359-100,BYT-ORB604359-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | M(3)95A |
| This Drosophila RpS3 protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 31.5 kDa |
| UniProt: | Q06559 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Drosophila melanogaster (Fruit fly) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL |
| Anwendungsbeschreibung: | Biological Origin: Drosophila melanogaster (Fruit fly). Application Notes: Full Length |



