Drosophila RpS3 protein

Produktübersicht

• Artikelname: Drosophila RpS3 protein
• Artikelnummer: BYT-ORB604359
• Hersteller Artikelnummer: orb604359
• Alternativnummer: BYT-ORB604359-1,BYT-ORB604359-100,BYT-ORB604359-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: M(3)95A

Produktbeschreibung

This Drosophila RpS3 protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 31.5 kDa
• UniProt: Q06559
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Drosophila melanogaster (Fruit fly)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Drosophila melanogaster (Fruit fly). Application Notes: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Drosophila melanogaster (Fruit fly) RpS3.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Drosophila melanogaster (Fruit fly) RpS3.