Drosophila RpS3 protein
Catalog Number:
BYT-ORB604359
- Images (3)
| Article Name: | Drosophila RpS3 protein |
| Biozol Catalog Number: | BYT-ORB604359 |
| Supplier Catalog Number: | orb604359 |
| Alternative Catalog Number: | BYT-ORB604359-1,BYT-ORB604359-100,BYT-ORB604359-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | M(3)95A |
| This Drosophila RpS3 protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 31.5 kDa |
| UniProt: | Q06559 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Drosophila melanogaster (Fruit fly) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL |
| Application Notes: | Biological Origin: Drosophila melanogaster (Fruit fly). Application Notes: Full Length |



