Bacteria tpd protein

Produktübersicht

• Artikelname: Bacteria tpd protein
• Artikelnummer: BYT-ORB604594
• Hersteller Artikelnummer: orb604594
• Alternativnummer: BYT-ORB604594-20,BYT-ORB604594-100,BYT-ORB604594-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Pathogen-specific membrane antigen

Produktbeschreibung

This Bacteria tpd protein spans the amino acid sequence from region 20-204aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 27.1 kDa
• UniProt: P19478
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Treponema pallidum (strain Nichols)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Treponema pallidum (strain Nichols). Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Treponema pallidum (strain Nichols) tpd.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Treponema pallidum (strain Nichols) tpd.