Bacteria tpd protein

Catalog Number: BYT-ORB604594
Article Name: Bacteria tpd protein
Biozol Catalog Number: BYT-ORB604594
Supplier Catalog Number: orb604594
Alternative Catalog Number: BYT-ORB604594-20,BYT-ORB604594-100,BYT-ORB604594-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Pathogen-specific membrane antigen
This Bacteria tpd protein spans the amino acid sequence from region 20-204aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 27.1 kDa
UniProt: P19478
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Treponema pallidum (strain Nichols)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Application Notes: Biological Origin: Treponema pallidum (strain Nichols). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Treponema pallidum (strain Nichols) tpd.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Treponema pallidum (strain Nichols) tpd.