Bacteria ctfB protein

Produktübersicht

• Artikelname: Bacteria ctfB protein
• Artikelnummer: BYT-ORB604641
• Hersteller Artikelnummer: orb604641
• Alternativnummer: BYT-ORB604641-20,BYT-ORB604641-100,BYT-ORB604641-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Acetoacetyl-CoA, acetate/butyrate CoA-transferase subunit B (Coat B)

Produktbeschreibung

This Bacteria ctfB protein spans the amino acid sequence from region 1-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 30.6 kDa
• UniProt: P23673
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) ctfB.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) ctfB.