Bacteria ctfB protein

Product Overview

• Article Name: Bacteria ctfB protein
• Biozol Catalog Number: BYT-ORB604641
• Supplier Catalog Number: orb604641
• Alternative Catalog Number: BYT-ORB604641-20,BYT-ORB604641-100,BYT-ORB604641-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Acetoacetyl-CoA, acetate/butyrate CoA-transferase subunit B (Coat B)

Product Description

This Bacteria ctfB protein spans the amino acid sequence from region 1-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 30.6 kDa
• UniProt: P23673
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV

Application Notes

• Application Notes: Biological Origin: Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787). Application Notes: Full Length

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) ctfB.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) ctfB.