Virus gB protein

Produktübersicht

• Artikelname: Virus gB protein
• Artikelnummer: BYT-ORB604693
• Hersteller Artikelnummer: orb604693
• Alternativnummer: BYT-ORB604693-20,BYT-ORB604693-100,BYT-ORB604693-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: gB

Produktbeschreibung

This Virus gB protein spans the amino acid sequence from region 23-259aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 31.4 kDa
• UniProt: P52352
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DFVMTGHNQHLPFRICSIATGTDLVRFDREVSCASYGSNIKTTEGILIIYKTKIEAHTFSVRTFKKELTFQTTYRDVGTVYFLDRTVTTLPMPIEEVHMVNTEARCLSSISVKRSEEEEYVAYHKDEYVNKTLDLIPLNFKSDTVRRYITTKEPFLRNGPLWFYSTSTSINCIVTDCIAKTKYPFDFFALSTGETVEGSPFYNGINSKTFNEPTEKILFRNNYTMLKTFDDGSKGNF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus). Application Notes: Partial

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus) gB.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus) gB.