Virus gB protein

Catalog Number: BYT-ORB604693
Article Name: Virus gB protein
Biozol Catalog Number: BYT-ORB604693
Supplier Catalog Number: orb604693
Alternative Catalog Number: BYT-ORB604693-20,BYT-ORB604693-100,BYT-ORB604693-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: gB
This Virus gB protein spans the amino acid sequence from region 23-259aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 31.4 kDa
UniProt: P52352
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DFVMTGHNQHLPFRICSIATGTDLVRFDREVSCASYGSNIKTTEGILIIYKTKIEAHTFSVRTFKKELTFQTTYRDVGTVYFLDRTVTTLPMPIEEVHMVNTEARCLSSISVKRSEEEEYVAYHKDEYVNKTLDLIPLNFKSDTVRRYITTKEPFLRNGPLWFYSTSTSINCIVTDCIAKTKYPFDFFALSTGETVEGSPFYNGINSKTFNEPTEKILFRNNYTMLKTFDDGSKGNF
Application Notes: Biological Origin: Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus) gB.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus) gB.