E. coli ompT protein

Artikelnummer: BYT-ORB604697
Artikelname: E. coli ompT protein
Artikelnummer: BYT-ORB604697
Hersteller Artikelnummer: orb604697
Alternativnummer: BYT-ORB604697-20,BYT-ORB604697-100,BYT-ORB604697-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Omptin Outer membrane protein 3B Protease A Protease VII
This E. coli ompT protein spans the amino acid sequence from region 21-317aa (G216K,K217G). Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 49.5 kDa
UniProt: P58603
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli O157:H7
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNR
Anwendungsbeschreibung: Biological Origin: Escherichia coli O157:H7. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O157: H7ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O157: H7ompT.