E. coli ompT protein

Product Overview

• Article Name: E. coli ompT protein
• Biozol Catalog Number: BYT-ORB604697
• Supplier Catalog Number: orb604697
• Alternative Catalog Number: BYT-ORB604697-20,BYT-ORB604697-100,BYT-ORB604697-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Omptin Outer membrane protein 3B Protease A Protease VII

Product Description

This E. coli ompT protein spans the amino acid sequence from region 21-317aa (G216K,K217G). Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 49.5 kDa
• UniProt: P58603
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia coli O157:H7
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNR

Application Notes

• Application Notes: Biological Origin: Escherichia coli O157:H7. Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O157: H7ompT.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O157: H7ompT.