E. coli tdcD protein

Produktübersicht

• Artikelname: E. coli tdcD protein
• Artikelnummer: BYT-ORB604698
• Hersteller Artikelnummer: orb604698
• Alternativnummer: BYT-ORB604698-20,BYT-ORB604698-100,BYT-ORB604698-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: tdcD, c3873, Propionate kinase, EC 2.7.2.15

Produktbeschreibung

This E. coli tdcD protein spans the amino acid sequence from region 1-402aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 50.4 kDa
• UniProt: P59244
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNEFPVVLVINCGSSSIKFSVLNASDCEVLMSGIADGINSENAFLSVNGGEPAPLAHHSYEGALKAIAFELEKRNLNDNVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSPLAPLHNYANLSGIESAQQLFPGVTQVAVFDTSFHQTMAPEAYLYGLPWKYYEELGVRRYGFHGTSHRYVSQRAHSLLNLAEDDSGLVVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMSWVASQTNQS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) tdcD.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) tdcD.