E. coli tdcD protein

Catalog Number: BYT-ORB604698
Article Name: E. coli tdcD protein
Biozol Catalog Number: BYT-ORB604698
Supplier Catalog Number: orb604698
Alternative Catalog Number: BYT-ORB604698-20,BYT-ORB604698-100,BYT-ORB604698-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: tdcD, c3873, Propionate kinase, EC 2.7.2.15
This E. coli tdcD protein spans the amino acid sequence from region 1-402aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 50.4 kDa
UniProt: P59244
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNEFPVVLVINCGSSSIKFSVLNASDCEVLMSGIADGINSENAFLSVNGGEPAPLAHHSYEGALKAIAFELEKRNLNDNVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSPLAPLHNYANLSGIESAQQLFPGVTQVAVFDTSFHQTMAPEAYLYGLPWKYYEELGVRRYGFHGTSHRYVSQRAHSLLNLAEDDSGLVVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMSWVASQTNQS
Application Notes: Biological Origin: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) tdcD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) tdcD.