Bacteria Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein

Produktübersicht

• Artikelname: Bacteria Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein
• Artikelnummer: BYT-ORB604716
• Hersteller Artikelnummer: orb604716
• Alternativnummer: BYT-ORB604716-20,BYT-ORB604716-100,BYT-ORB604716-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Gene product 4 (Gp4)

Produktbeschreibung

This Bacteria Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein spans the amino acid sequence from region 151-548aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 51.3 kDa
• UniProt: P03692
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Escherichia phage T7 (Bacteriophage T7)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Escherichia phage T7 (Bacteriophage T7). Application Notes: Partial

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T7 (Bacteriophage T7) 4.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T7 (Bacteriophage T7) 4.