Bacteria Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein

Product Overview

• Article Name: Bacteria Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein
• Biozol Catalog Number: BYT-ORB604716
• Supplier Catalog Number: orb604716
• Alternative Catalog Number: BYT-ORB604716-20,BYT-ORB604716-100,BYT-ORB604716-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Gene product 4 (Gp4)

Product Description

This Bacteria Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein spans the amino acid sequence from region 151-548aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 51.3 kDa
• UniProt: P03692
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia phage T7 (Bacteriophage T7)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: KKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRL

Application Notes

• Application Notes: Biological Origin: Escherichia phage T7 (Bacteriophage T7). Application Notes: Partial

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T7 (Bacteriophage T7) 4.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T7 (Bacteriophage T7) 4.