Virus Nuclear export protein(NS) protein

Produktübersicht

• Artikelname: Virus Nuclear export protein(NS) protein
• Artikelnummer: BYT-ORB604780
• Hersteller Artikelnummer: orb604780
• Alternativnummer: BYT-ORB604780-20,BYT-ORB604780-100,BYT-ORB604780-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Non-structural protein 2 (NS2) (NEP)

Produktbeschreibung

This Virus Nuclear export protein(NS) protein spans the amino acid sequence from region 1-122aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 21.8 kDa
• UniProt: P08014
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Influenza B virus (strain B/Yamagata/1/1973)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Influenza B virus (strain B/Yamagata/1/1973). Application Notes: Full Length

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza B virus (strain B/Yamagata/1/1973) NS.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza B virus (strain B/Yamagata/1/1973) NS.