Virus Nuclear export protein(NS) protein

Product Overview

• Article Name: Virus Nuclear export protein(NS) protein
• Biozol Catalog Number: BYT-ORB604780
• Supplier Catalog Number: orb604780
• Alternative Catalog Number: BYT-ORB604780-20,BYT-ORB604780-100,BYT-ORB604780-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Non-structural protein 2 (NS2) (NEP)

Product Description

This Virus Nuclear export protein(NS) protein spans the amino acid sequence from region 1-122aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 21.8 kDa
• UniProt: P08014
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Influenza B virus (strain B/Yamagata/1/1973)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Application Notes

• Application Notes: Biological Origin: Influenza B virus (strain B/Yamagata/1/1973). Application Notes: Full Length

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza B virus (strain B/Yamagata/1/1973) NS.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza B virus (strain B/Yamagata/1/1973) NS.