Fungi sar protein

Produktübersicht

• Artikelname: Fungi sar protein
• Artikelnummer: BYT-ORB604804
• Hersteller Artikelnummer: orb604804
• Alternativnummer: BYT-ORB604804-20,BYT-ORB604804-100,BYT-ORB604804-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: rRNA endonuclease

Produktbeschreibung

This Fungi sar protein spans the amino acid sequence from region 28-177aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 25.2 kDa
• UniProt: P00655
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Aspergillus giganteus
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AVTWTCLNDQKNPKTNKYETKRLLYNQNKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLPKGRTPIKFGKSDCDRPPKHSKDGNGKTDHYLLEFPTFPDGHDYKFDSKKPKENPGPARVIYTYPNKVFCGIIAHTKENQGELKLCSH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Aspergillus giganteus. Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Aspergillus giganteussar.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Aspergillus giganteussar.