Fungi sar protein

Catalog Number: BYT-ORB604804
Article Name: Fungi sar protein
Biozol Catalog Number: BYT-ORB604804
Supplier Catalog Number: orb604804
Alternative Catalog Number: BYT-ORB604804-20,BYT-ORB604804-100,BYT-ORB604804-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: rRNA endonuclease
This Fungi sar protein spans the amino acid sequence from region 28-177aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 25.2 kDa
UniProt: P00655
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Aspergillus giganteus
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AVTWTCLNDQKNPKTNKYETKRLLYNQNKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLPKGRTPIKFGKSDCDRPPKHSKDGNGKTDHYLLEFPTFPDGHDYKFDSKKPKENPGPARVIYTYPNKVFCGIIAHTKENQGELKLCSH
Application Notes: Biological Origin: Aspergillus giganteus. Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Aspergillus giganteussar.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Aspergillus giganteussar.