Bacteria ruvC protein

Produktübersicht

• Artikelname: Bacteria ruvC protein
• Artikelnummer: BYT-ORB604838
• Hersteller Artikelnummer: orb604838
• Alternativnummer: BYT-ORB604838-20,BYT-ORB604838-100,BYT-ORB604838-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Holliday junction nuclease RuvC Holliday junction resolvase RuvC

Produktbeschreibung

This Bacteria ruvC protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 23.2 kDa
• UniProt: B2UP63
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Akkermansia muciniphila (strain ATCC BAA-835 / Muc)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Akkermansia muciniphila (strain ATCC BAA-835 / Muc). Application Notes: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Akkermansia muciniphila (strain ATCC BAA-835 / Muc) ruvC.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Akkermansia muciniphila (strain ATCC BAA-835 / Muc) ruvC.