Bacteria ruvC protein
Catalog Number:
BYT-ORB604838
- Images (3)
| Article Name: | Bacteria ruvC protein |
| Biozol Catalog Number: | BYT-ORB604838 |
| Supplier Catalog Number: | orb604838 |
| Alternative Catalog Number: | BYT-ORB604838-20,BYT-ORB604838-100,BYT-ORB604838-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Holliday junction nuclease RuvC Holliday junction resolvase RuvC |
| This Bacteria ruvC protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 23.2 kDa |
| UniProt: | B2UP63 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Akkermansia muciniphila (strain ATCC BAA-835 / Muc) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI |
| Application Notes: | Biological Origin: Akkermansia muciniphila (strain ATCC BAA-835 / Muc). Application Notes: Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Akkermansia muciniphila (strain ATCC BAA-835 / Muc) ruvC. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Akkermansia muciniphila (strain ATCC BAA-835 / Muc) ruvC. |
Product Guarantee and Expert Support
