Bacteria HSP100 protein

Produktübersicht

• Artikelname: Bacteria HSP100 protein
• Artikelnummer: BYT-ORB604850
• Hersteller Artikelnummer: orb604850
• Alternativnummer: BYT-ORB604850-20,BYT-ORB604850-100,BYT-ORB604850-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein CLP

Produktbeschreibung

This Bacteria HSP100 protein spans the amino acid sequence from region 1-138aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 22.9 kDa
• UniProt: O15885
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Trypanosoma cruzi
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NSPKGLEATREKVWQVVRSYFRPEFLNRLDDIVLFRRLGFGELHEIIDLIVAEVNGRLRSQDILLEVTDEAKNFVLENAFDAEMGARPLRRWVEKYITTEVSRMILAQQLPPNSTVRVLVNGSQGKLAFSVKRSFVSE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Trypanosoma cruzi. Application Notes: Full Length

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Trypanosoma cruziHSP100.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Trypanosoma cruziHSP100.