Bacteria HSP100 protein

Catalog Number: BYT-ORB604850
Article Name: Bacteria HSP100 protein
Biozol Catalog Number: BYT-ORB604850
Supplier Catalog Number: orb604850
Alternative Catalog Number: BYT-ORB604850-20,BYT-ORB604850-100,BYT-ORB604850-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein CLP
This Bacteria HSP100 protein spans the amino acid sequence from region 1-138aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.9 kDa
UniProt: O15885
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Trypanosoma cruzi
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NSPKGLEATREKVWQVVRSYFRPEFLNRLDDIVLFRRLGFGELHEIIDLIVAEVNGRLRSQDILLEVTDEAKNFVLENAFDAEMGARPLRRWVEKYITTEVSRMILAQQLPPNSTVRVLVNGSQGKLAFSVKRSFVSE
Application Notes: Biological Origin: Trypanosoma cruzi. Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Trypanosoma cruziHSP100.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Trypanosoma cruziHSP100.