Bovine PAG2 protein

Produktübersicht

• Artikelname: Bovine PAG2 protein
• Artikelnummer: BYT-ORB604922
• Hersteller Artikelnummer: orb604922
• Alternativnummer: BYT-ORB604922-20,BYT-ORB604922-100,BYT-ORB604922-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: PAG 2

Produktbeschreibung

This Bovine PAG2 protein spans the amino acid sequence from region 22-376aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 43.6 kDa
• UniProt: Q28057
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bos taurus (Bovine)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Bos taurus (Bovine). Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG2.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG2.