Bovine PAG2 protein

Catalog Number: BYT-ORB604922
Article Name: Bovine PAG2 protein
Biozol Catalog Number: BYT-ORB604922
Supplier Catalog Number: orb604922
Alternative Catalog Number: BYT-ORB604922-20,BYT-ORB604922-100,BYT-ORB604922-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: PAG 2
This Bovine PAG2 protein spans the amino acid sequence from region 22-376aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 43.6 kDa
UniProt: Q28057
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bos taurus (Bovine)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGP
Application Notes: Biological Origin: Bos taurus (Bovine). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG2.