Virus omp25 protein

Produktübersicht

• Artikelname: Virus omp25 protein
• Artikelnummer: BYT-ORB604940
• Hersteller Artikelnummer: orb604940
• Alternativnummer: BYT-ORB604940-20,BYT-ORB604940-100,BYT-ORB604940-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: omp25, BruAb1_0720, 25 kDa outer-membrane immunogenic protein

Produktbeschreibung

This Virus omp25 protein spans the amino acid sequence from region 24-213aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 27.8 kDa
• UniProt: Q44664
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Brucella abortus biovar 1 (strain 9-941)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Brucella abortus biovar 1 (strain 9-941). Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus biovar 1 (strain 9-941) omp25.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus biovar 1 (strain 9-941) omp25.