Virus omp25 protein

Product Overview

• Article Name: Virus omp25 protein
• Biozol Catalog Number: BYT-ORB604940
• Supplier Catalog Number: orb604940
• Alternative Catalog Number: BYT-ORB604940-20,BYT-ORB604940-100,BYT-ORB604940-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: omp25, BruAb1_0720, 25 kDa outer-membrane immunogenic protein

Product Description

This Virus omp25 protein spans the amino acid sequence from region 24-213aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 27.8 kDa
• UniProt: Q44664
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Brucella abortus biovar 1 (strain 9-941)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF

Application Notes

• Application Notes: Biological Origin: Brucella abortus biovar 1 (strain 9-941). Application Notes: Full Length of Mature Protein

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus biovar 1 (strain 9-941) omp25.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus biovar 1 (strain 9-941) omp25.