Mouse Dsg1a protein

Produktübersicht

• Artikelname: Mouse Dsg1a protein
• Artikelnummer: BYT-ORB604975
• Hersteller Artikelnummer: orb604975
• Alternativnummer: BYT-ORB604975-20,BYT-ORB604975-100,BYT-ORB604975-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: DG1 (DGI) (Desmosomal glycoprotein I) (Desmoglein-1) (Dsg1-alpha) (Dsg1)

Produktbeschreibung

This Mouse Dsg1a protein spans the amino acid sequence from region 50-564aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 77.2 kDa
• UniProt: Q61495
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EWIKFAAACREGEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQKTGEINITSIVDREVTPFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFLGQIEENSNANTLVMKLNATDADEPNNLNSMIAFKIIRQEPSDSPMFIINRKTGEIRTMNNFLDREQYSQYSLVVRGSDRDGGADGMSAESECSITILDVNDNIPYLEQSSYDITIEENALHSQLVQIRVIDLDEEFSDNWK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular Domain

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Dsg1a.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Dsg1a.