Mouse Dsg1a protein

Catalog Number: BYT-ORB604975
Article Name: Mouse Dsg1a protein
Biozol Catalog Number: BYT-ORB604975
Supplier Catalog Number: orb604975
Alternative Catalog Number: BYT-ORB604975-20,BYT-ORB604975-100,BYT-ORB604975-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DG1 (DGI) (Desmosomal glycoprotein I) (Desmoglein-1) (Dsg1-alpha) (Dsg1)
This Mouse Dsg1a protein spans the amino acid sequence from region 50-564aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 77.2 kDa
UniProt: Q61495
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EWIKFAAACREGEDNSKRNPIAKIHSDCAANQPVTYRISGVGIDQPPYGIFIINQKTGEINITSIVDREVTPFFIIYCRALNAQGQDLENPLELRVRVMDINDNPPVFSMTTFLGQIEENSNANTLVMKLNATDADEPNNLNSMIAFKIIRQEPSDSPMFIINRKTGEIRTMNNFLDREQYSQYSLVVRGSDRDGGADGMSAESECSITILDVNDNIPYLEQSSYDITIEENALHSQLVQIRVIDLDEEFSDNWK
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular Domain
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Dsg1a.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Dsg1a.