Fungi Pregnancy-associated glycoprotein 1 protein

Produktübersicht

• Artikelname: Fungi Pregnancy-associated glycoprotein 1 protein
• Artikelnummer: BYT-ORB604983
• Hersteller Artikelnummer: orb604983
• Alternativnummer: BYT-ORB604983-20,BYT-ORB604983-100,BYT-ORB604983-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Alkaline serine protease ver112, EC 3.4.21.-

Produktbeschreibung

This Fungi Pregnancy-associated glycoprotein 1 protein spans the amino acid sequence from region 103-382aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 36.0 kDa
• UniProt: Q68GV9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Lecanicillium psalliotae (Verticillium psalliotae)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AITQQQGATWGLTRISHRARGSTAYAYDTSAGAGACVYVIDTGVEDTHPDFEGRAKQIKSYASTARDGHGHGTHCAGTIGSKTWGVAKKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGGYSAALNQAAARLQSSGVFVAVAAGNDNRDAANTSPASEPTVCTVGATDSNDVRSTFSNYGRVVDIFAPGTSITSTWIGGRTNTISGTSMATPHIAGLAAYLFGLEGGSAGAMCGRIQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Lecanicillium psalliotae (Verticillium psalliotae). Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lecanicillium psalliotae (Verticillium psalliotae).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lecanicillium psalliotae (Verticillium psalliotae).