Fungi Pregnancy-associated glycoprotein 1 protein

Product Overview

• Article Name: Fungi Pregnancy-associated glycoprotein 1 protein
• Biozol Catalog Number: BYT-ORB604983
• Supplier Catalog Number: orb604983
• Alternative Catalog Number: BYT-ORB604983-20,BYT-ORB604983-100,BYT-ORB604983-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Alkaline serine protease ver112, EC 3.4.21.-

Product Description

This Fungi Pregnancy-associated glycoprotein 1 protein spans the amino acid sequence from region 103-382aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 36.0 kDa
• UniProt: Q68GV9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Lecanicillium psalliotae (Verticillium psalliotae)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AITQQQGATWGLTRISHRARGSTAYAYDTSAGAGACVYVIDTGVEDTHPDFEGRAKQIKSYASTARDGHGHGTHCAGTIGSKTWGVAKKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGGYSAALNQAAARLQSSGVFVAVAAGNDNRDAANTSPASEPTVCTVGATDSNDVRSTFSNYGRVVDIFAPGTSITSTWIGGRTNTISGTSMATPHIAGLAAYLFGLEGGSAGAMCGRIQ

Application Notes

• Application Notes: Biological Origin: Lecanicillium psalliotae (Verticillium psalliotae). Application Notes: Full Length of Mature Protein

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lecanicillium psalliotae (Verticillium psalliotae).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lecanicillium psalliotae (Verticillium psalliotae).