Bacteria mazF protein
Artikelnummer:
BYT-ORB605147
- Bilder (3)
| Artikelname: | Bacteria mazF protein |
| Artikelnummer: | BYT-ORB605147 |
| Hersteller Artikelnummer: | orb605147 |
| Alternativnummer: | BYT-ORB605147-20,BYT-ORB605147-100,BYT-ORB605147-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Toxin MazF (mRNA interferase MazF) |
| This Bacteria mazF protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 19.0 kDa |
| UniProt: | Q9F7V5 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Staphylococcus epidermidis |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS |
| Anwendungsbeschreibung: | Biological Origin: Staphylococcus epidermidis. Application Notes: Full Length |



