Bacteria mazF protein

Catalog Number: BYT-ORB605147
Article Name: Bacteria mazF protein
Biozol Catalog Number: BYT-ORB605147
Supplier Catalog Number: orb605147
Alternative Catalog Number: BYT-ORB605147-20,BYT-ORB605147-100,BYT-ORB605147-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Toxin MazF (mRNA interferase MazF)
This Bacteria mazF protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.0 kDa
UniProt: Q9F7V5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus epidermidis
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITDGINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Application Notes: Biological Origin: Staphylococcus epidermidis. Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus epidermidismazF.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus epidermidismazF.