Porcine CLCA1 protein

Produktübersicht

• Artikelname: Porcine CLCA1 protein
• Artikelnummer: BYT-ORB605158
• Hersteller Artikelnummer: orb605158
• Alternativnummer: BYT-ORB605158-20,BYT-ORB605158-100,BYT-ORB605158-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Calcium-activated chloride channel family member 1 pCLCA1 AECC

Produktbeschreibung

This Porcine CLCA1 protein spans the amino acid sequence from region 46-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 22.8 kDa
• UniProt: Q9TUB5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Sus scrofa (Pig)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.