Porcine CLCA1 protein

Catalog Number: BYT-ORB605158
Article Name: Porcine CLCA1 protein
Biozol Catalog Number: BYT-ORB605158
Supplier Catalog Number: orb605158
Alternative Catalog Number: BYT-ORB605158-20,BYT-ORB605158-100,BYT-ORB605158-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Calcium-activated chloride channel family member 1 pCLCA1 AECC
This Porcine CLCA1 protein spans the amino acid sequence from region 46-199aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 22.8 kDa
UniProt: Q9TUB5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) CLCA1.