Human ACSS3 protein

Produktübersicht

• Artikelname: Human ACSS3 protein
• Artikelnummer: BYT-ORB605164
• Hersteller Artikelnummer: orb605164
• Alternativnummer: BYT-ORB605164-20,BYT-ORB605164-100,BYT-ORB605164-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Acyl-CoA synthetase short-chain family member 3

Produktbeschreibung

This Human ACSS3 protein spans the amino acid sequence from region 30-686aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 77.9 kDa
• UniProt: Q9H6R3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACSS3.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACSS3.