Human ACSS3 protein

Catalog Number: BYT-ORB605164
Article Name: Human ACSS3 protein
Biozol Catalog Number: BYT-ORB605164
Supplier Catalog Number: orb605164
Alternative Catalog Number: BYT-ORB605164-20,BYT-ORB605164-100,BYT-ORB605164-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Acyl-CoA synthetase short-chain family member 3
This Human ACSS3 protein spans the amino acid sequence from region 30-686aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 77.9 kDa
UniProt: Q9H6R3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHD
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACSS3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ACSS3.