Human GCGR protein

Produktübersicht

• Artikelname: Human GCGR protein
• Artikelnummer: BYT-ORB605217
• Hersteller Artikelnummer: orb605217
• Alternativnummer: BYT-ORB605217-20,BYT-ORB605217-100,BYT-ORB605217-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (GL-R)

Produktbeschreibung

This Human GCGR protein spans the amino acid sequence from region 26-136aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 18.1 kDa
• UniProt: P47871
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 µg/mL can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL. Application Notes: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 µg/ml can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.