Human GCGR protein

Product Overview

• Article Name: Human GCGR protein
• Biozol Catalog Number: BYT-ORB605217
• Supplier Catalog Number: orb605217
• Alternative Catalog Number: BYT-ORB605217-20,BYT-ORB605217-100,BYT-ORB605217-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: (GL-R)

Product Description

This Human GCGR protein spans the amino acid sequence from region 26-136aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 18.1 kDa
• UniProt: P47871
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 µg/mL can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL. Application Notes: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 µg/ml can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.