Human KRT18 protein

Produktübersicht

• Artikelname: Human KRT18 protein
• Artikelnummer: BYT-ORB605230
• Hersteller Artikelnummer: orb605230
• Alternativnummer: BYT-ORB605230-20,BYT-ORB605230-100,BYT-ORB605230-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cell proliferation-inducing gene 46 protein (Cytokeratin-18) (CK-18) (Keratin-18) (K18) (CYK18)

Produktbeschreibung

This Human KRT18 protein spans the amino acid sequence from region 2-430aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 50.8 kDa
• UniProt: P05783
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of KRT18 was greater than 90% as determined by SEC-HPLC