Human KRT18 protein

Catalog Number: BYT-ORB605230
Article Name: Human KRT18 protein
Biozol Catalog Number: BYT-ORB605230
Supplier Catalog Number: orb605230
Alternative Catalog Number: BYT-ORB605230-20,BYT-ORB605230-100,BYT-ORB605230-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cell proliferation-inducing gene 46 protein (Cytokeratin-18) (CK-18) (Keratin-18) (K18) (CYK18)
This Human KRT18 protein spans the amino acid sequence from region 2-430aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 50.8 kDa
UniProt: P05783
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQY
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of KRT18 was greater than 90% as determined by SEC-HPLC