Rat Mertk protein

Produktübersicht

• Artikelname: Rat Mertk protein
• Artikelnummer: BYT-ORB605234
• Hersteller Artikelnummer: orb605234
• Alternativnummer: BYT-ORB605234-20,BYT-ORB605234-100,BYT-ORB605234-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Proto-oncogene c-Mer (Receptor tyrosine kinase MerTK)

Produktbeschreibung

This Rat Mertk protein spans the amino acid sequence from region 19-497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 55.5 kDa
• UniProt: P57097
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Rattus norvegicus (Rat)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GGTAEKEEEIKPDQPFSGPLPGSLPADHRPFFAPHSSGDQLSPSQTGRSHPAHTATPQMTSAASNLLPPVAFKNTIGRIVLSEHKSVKFNCSINIPNVYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSITSVQRSDNGSYICKMKVNDREVVSDPIYVEVQGLPYFTKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNENPERSPSVLTVAGLTETAVFSCEAHNDKGLTVSKGVQI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Partial

Bilder

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Rattus norvegicus (Rat) Mertk.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Rattus norvegicus (Rat) Mertk.

The purity of Mertk was greater than 95% as determined by SEC-HPLC