Rat Mertk protein
Catalog Number:
BYT-ORB605234
- Images (3)
| Article Name: | Rat Mertk protein |
| Biozol Catalog Number: | BYT-ORB605234 |
| Supplier Catalog Number: | orb605234 |
| Alternative Catalog Number: | BYT-ORB605234-20,BYT-ORB605234-100,BYT-ORB605234-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Proto-oncogene c-Mer (Receptor tyrosine kinase MerTK) |
| This Rat Mertk protein spans the amino acid sequence from region 19-497aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 55.5 kDa |
| UniProt: | P57097 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Rattus norvegicus (Rat) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GGTAEKEEEIKPDQPFSGPLPGSLPADHRPFFAPHSSGDQLSPSQTGRSHPAHTATPQMTSAASNLLPPVAFKNTIGRIVLSEHKSVKFNCSINIPNVYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSITSVQRSDNGSYICKMKVNDREVVSDPIYVEVQGLPYFTKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNENPERSPSVLTVAGLTETAVFSCEAHNDKGLTVSKGVQI |
| Application Notes: | Biological Origin: Rattus norvegicus (Rat). Application Notes: Partial |
|
|
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Rattus norvegicus (Rat) Mertk. |
|
|
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Rattus norvegicus (Rat) Mertk. |
|
|
The purity of Mertk was greater than 95% as determined by SEC-HPLC |
Product Guarantee and Expert Support
