Rabbit TFPI protein

Artikelnummer: BYT-ORB605252
Artikelname: Rabbit TFPI protein
Artikelnummer: BYT-ORB605252
Hersteller Artikelnummer: orb605252
Alternativnummer: BYT-ORB605252-20,BYT-ORB605252-100,BYT-ORB605252-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
This Rabbit TFPI protein spans the amino acid sequence from region 25-300aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 35.4 kDa
UniProt: P19761
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Oryctolagus cuniculus (Rabbit)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKT
Anwendungsbeschreibung: Biological Origin: Oryctolagus cuniculus (Rabbit). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 µg/mL can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 µg/ml can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.